}, "disallowZeroCount" : "false", Bist du sicher, dass du fortfahren möchtest? { }); }, "event" : "markAsSpamWithoutRedirect", }, } LITHIUM.AjaxSupport.ComponentEvents.set({ ], "context" : "lia-deleted-state", { { ] ] }, { "disableKudosForAnonUser" : "false", "accessibility" : false, }, "action" : "addClassName" { if ( watching ) { "actions" : [ "context" : "envParam:entity", }, "event" : "kudoEntity", "action" : "rerender" }, "actions" : [ "actions" : [ { "action" : "rerender" "context" : "", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":373092,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. ] ] }, })(LITHIUM.jQuery); { "action" : "rerender" ] LITHIUM.InputEditForm("form_1", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. } }, }, }, // Set start to true only if the first key in the sequence is pressed "event" : "MessagesWidgetAnswerForm", } "context" : "", "event" : "MessagesWidgetAnswerForm", ] "actions" : [ ] { ] LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche läuft...","emptyText":"Keine Treffer","successText":"Ergebnisse:","defaultText":"Suchbegriff eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#noteSearchField_66ade5a1fae24c_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.notesearchfield.notesearchfield:autocomplete?t:ac=board-id/Archiv_Mobilfunk/thread-id/41962&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "selector" : "#messageview_5", "actions" : [ "action" : "rerender" { { }, LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.StarRating('#any_7', false, 1, 'LITHIUM:starRating'); "accessibility" : false, { LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); "event" : "MessagesWidgetEditAnswerForm", "actions" : [ "useSimpleView" : "false", "useTruncatedSubject" : "true", { "event" : "MessagesWidgetEditAction", "actions" : [ "actions" : [ "quiltName" : "ForumMessage", "action" : "rerender" ] "actions" : [ ","loaderSelector":"#lineardisplaymessageviewwrapper_4 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); }, }, "kudosable" : "true", "event" : "addMessageUserEmailSubscription", }, "truncateBody" : "true", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "envParam:quiltName,message,product,contextId,contextUrl", } } LITHIUM.AjaxSupport.fromLink('#kudoEntity', 'kudoEntity', '#ajaxfeedback', 'LITHIUM:ajaxError', {}, '3T2zxqQcR5vHet6Uupqg3h43SezmCxZgZKGSZ5JTd6M. { "action" : "pulsate" "showCountOnly" : "false", "context" : "envParam:quiltName,expandedQuiltName", { Sie möchten nicht mehr am Lastschriftverfahren teilnehmen. }, { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] "event" : "approveMessage", "event" : "unapproveMessage", "event" : "MessagesWidgetEditCommentForm", $('#user-menu .lia-header-nav-component-unread-count').each(function(e) { Phasmophobia: Wie können Probleme mit der Spracherkennung gelöst werden? { ] }, { "linkDisabled" : "false" "context" : "envParam:quiltName,expandedQuiltName", "action" : "pulsate" "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_17","feedbackSelector":".InfoMessage"}); "context" : "envParam:quiltName", "actions" : [ { { ;(function($) { "event" : "markAsSpamWithoutRedirect", "action" : "rerender" "event" : "RevokeSolutionAction", "disableLabelLinks" : "false", "event" : "markAsSpamWithoutRedirect", { "context" : "envParam:entity", "kudosable" : "true", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ "action" : "rerender" "event" : "removeThreadUserEmailSubscription", ] "event" : "addMessageUserEmailSubscription", "kudosable" : "true", "displaySubject" : "true", "action" : "pulsate" ] } { "action" : "rerender" { }, "actions" : [ } "action" : "rerender" { "event" : "markAsSpamWithoutRedirect", }, ] "action" : "rerender" "context" : "", ;(function($) { if ( key == neededkeys[0] ) { "actions" : [ "context" : "", "forceSearchRequestParameterForBlurbBuilder" : "false", "event" : "AcceptSolutionAction", if ( neededkeys[count] == key ) { "action" : "rerender" ] { ] "actions" : [ count = 0; LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche nach Benutzern läuft...","emptyText":"Keine Treffer","successText":"Gefundene Benutzer:","defaultText":"Benutzernamen oder Rang eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_66ade5a1fae24c","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/Archiv_Mobilfunk/thread-id/41962&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); { "context" : "", // just for convenience, you need a login anyways... }, LITHIUM.AjaxSupport.fromLink('#kudoEntity_3', 'kudoEntity', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {}, 'e9z6P2_Aihu6ykzku_KMPpcC7jIldIlH_Bzdgtkg2jI. logmein: [76, 79, 71, 77, 69, 73, 78], LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); "action" : "addClassName" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_7","feedbackSelector":".InfoMessage"}); { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_30","feedbackSelector":".InfoMessage"}); }, "quiltName" : "ForumMessage", { ] } "kudosLinksDisabled" : "false", { Da die mir mal 15€ aufgeladen haben ohne meine Einverständnis hab ich das per Bank zurückgezogen und jetzt ist die Karte im Minus muss ich den Betrag jetzt bis irgendwann ausgleichen weil ich sehe das nicht ein die haben ohne meine Erlaubnis einfach abgebucht und ES IST KEIN VERTRAG! ] } { "actions" : [ LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_6","componentSelector":"#lineardisplaymessageviewwrapper_6","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":373824,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "event" : "removeThreadUserEmailSubscription", ;(function($) { window.scrollTo(0,position_x.top - 150); { ] "initiatorDataMatcher" : "data-lia-kudos-id" "useSubjectIcons" : "true", "action" : "rerender" } "actions" : [ '; { }, "context" : "envParam:quiltName,expandedQuiltName", "entity" : "373420", } "action" : "rerender" "parameters" : { "initiatorDataMatcher" : "data-lia-kudos-id" "disableLabelLinks" : "false", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_27","feedbackSelector":".InfoMessage"}); ] "context" : "envParam:quiltName", "context" : "envParam:quiltName,expandedQuiltName", var cookieDomain = 'forum.vodafone.de'; } { "action" : "rerender" "actions" : [ var count = 0; { "actions" : [ }, ] ] Diese Zahlungsmethode wird monatlich mit 2,50 Euro berechnet. "event" : "MessagesWidgetEditAction", } "event" : "ProductAnswerComment", trotzdem können die immer noch aufs pay-pal Konto zugreifen. "buttonDialogCloseAlt" : "Schließen", "event" : "MessagesWidgetEditCommentForm", }, "event" : "ProductAnswer", } { "action" : "rerender" "actions" : [ } "actions" : [ "actions" : [ { "event" : "MessagesWidgetMessageEdit", "context" : "envParam:entity", "actions" : [ Der Vertrag sollte sofort annulliert werden. "messageViewOptions" : "1111110111111111111110111110100101001101" { LITHIUM.StarRating('#any_0', true, 2, 'LITHIUM:starRating'); watching = false; { LITHIUM.AjaxSupport.fromLink('#kudoEntity_5', 'kudoEntity', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {}, '6j0-wWQBqgQJpAfNO1I1N_6Nzz4aIFadNh_NE2BGd7U. "event" : "AcceptSolutionAction", { "displaySubject" : "true", ] { "context" : "", "actions" : [ }, ] ] "useSubjectIcons" : "true", "action" : "rerender" { { "message" : "373116", "componentId" : "forums.widget.message-view", ] "actions" : [ ] Laut Vorgabe wird das Konto dann nur aufgeladen, wenn das Guthaben „unter fünf Euro“ fällt. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_24","feedbackSelector":".InfoMessage"}); "event" : "ProductAnswer", "actions" : [ LITHIUM.SearchAutoCompleteToggle({"containerSelector":"#searchautocompletetoggle_66ade5a1fae24c","enableAutoCompleteSelector":".search-autocomplete-toggle-link","enableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:enableAutoComplete","disableAutoCompleteSelector":".lia-autocomplete-toggle-off","disableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:disableAutoComplete","autoCompleteSelector":".lia-autocomplete-input"}); { "disallowZeroCount" : "false", } } "context" : "", { LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":371350}},{"elementId":"link_10","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":371354}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":372988}},{"elementId":"link_18","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":373092}},{"elementId":"link_22","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":373116}},{"elementId":"link_26","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":373238}},{"elementId":"link_30","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":373420}},{"elementId":"link_34","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":373824}},{"elementId":"link_36","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1423764}}]); "event" : "QuickReply", { } { "action" : "rerender" "context" : "", }, { lithstudio: [], "action" : "rerender" "context" : "", { }, "action" : "rerender" ;(function($) { "actions" : [ { "event" : "addThreadUserEmailSubscription", ] "messageViewOptions" : "1111110111111111111110111110100101001101" }, "useSubjectIcons" : "true", { LITHIUM.InputEditForm("form_2", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. ;(function($){ "initiatorBinding" : true, { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "context" : "", ] "action" : "rerender" }); LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234328}); { { ] }, ] "context" : "", }, }, { LITHIUM.Dialog.options['1699384947'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "initiatorDataMatcher" : "data-lia-kudos-id" "action" : "rerender" "actions" : [ { "context" : "envParam:quiltName", { LITHIUM.StarRating('#any_0_3', true, 2, 'LITHIUM:starRating'); }, "parameters" : { "action" : "rerender" "event" : "MessagesWidgetEditCommentForm", } "context" : "", ] "truncateBody" : "true", }, "includeRepliesModerationState" : "false", { } "event" : "MessagesWidgetCommentForm", } "eventActions" : [ "actions" : [ ] LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-373092 .lia-rating-control-passive', '#form_2'); "disableLinks" : "false", watching = false; LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/41962","ajaxErrorEventName":"LITHIUM:ajaxError","token":"Nr8N55nwZnK6a-EHESaZ6BXOKuTnQ9jhv9REjnqoWeY. "actions" : [ "event" : "MessagesWidgetEditCommentForm", }, LITHIUM.Dialog.options['145577803'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; Liegt es jedoch zwischen 5 und 7,98 Euro, kann der monatliche Paketpreis nicht abgebucht werden. { "context" : "", "event" : "unapproveMessage", }, }, "actions" : [ ] Versuchen Sie es nach der Verbindungsherstellung erneut. element.find('ul').slideUp(); "actions" : [ "actions" : [ } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_37","feedbackSelector":".InfoMessage"}); { "actions" : [ "showCountOnly" : "false", "truncateBodyRetainsHtml" : "false", "action" : "rerender" { "actions" : [ "context" : "envParam:quiltName,message,product,contextId,contextUrl", "event" : "markAsSpamWithoutRedirect", } { { "initiatorDataMatcher" : "data-lia-kudos-id" "action" : "rerender" "actions" : [ "context" : "", "actions" : [ "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "parameters" : { })(LITHIUM.jQuery); { { var keycodes = { LITHIUM.StarRating('#any_0_3', true, 2, 'LITHIUM:starRating'); "context" : "", }, "quiltName" : "ForumMessage", { ] "componentId" : "forums.widget.message-view", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-372988 .lia-rating-control-passive', '#form_1'); "action" : "rerender" { { } "event" : "unapproveMessage", } ] "includeRepliesModerationState" : "false", LITHIUM.InputEditForm("form_2", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "actions" : [ "initiatorDataMatcher" : "data-lia-kudos-id" "action" : "rerender" }, $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "context" : "", // --> "event" : "MessagesWidgetEditAnswerForm", "actions" : [ { "actions" : [ }, ] "event" : "expandMessage", 0,70 €. } "action" : "rerender" "quiltName" : "ForumMessage", { } "actions" : [ } } "action" : "rerender" "context" : "", } LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-373238 .lia-rating-control-passive', '#form_4'); { { { "action" : "rerender" { { "includeRepliesModerationState" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_21","feedbackSelector":".InfoMessage"}); }, "triggerEvent" : "click", "action" : "rerender" "actions" : [ }); ] { "entity" : "373238", }, } }); { "context" : "", "event" : "RevokeSolutionAction", ] "action" : "rerender" "accessibility" : false, "truncateBody" : "true", ] "action" : "pulsate" "event" : "editProductMessage", // --> "useCountToKudo" : "false", } "actions" : [ "context" : "", } } $(event.data.selector).addClass('cssmenu-open') LITHIUM.Dialog.options['-667586125'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; ] "disableLinks" : "false", ] "disableLabelLinks" : "false", "event" : "removeThreadUserEmailSubscription", "initiatorDataMatcher" : "data-lia-message-uid" }, "initiatorDataMatcher" : "data-lia-message-uid" "action" : "rerender" }, "context" : "envParam:quiltName", }, "entity" : "373092", } }, ] { "selector" : "#kudosButtonV2_5", }); { { { } "actions" : [ { }, }, { } }, "disallowZeroCount" : "false", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "envParam:quiltName,product,contextId,contextUrl", { LITHIUM.MessageBodyDisplay('#bodyDisplay_3', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "event" : "MessagesWidgetEditCommentForm", }, "action" : "rerender" "actions" : [ "event" : "editProductMessage", "context" : "", var msg = $(".message-uid-373824"); "displayStyle" : "horizontal", "disableLabelLinks" : "false", "actions" : [ ] }, ], "context" : "", "action" : "rerender" }, ] watching = true; "action" : "rerender" ] ). }, LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_2","menuItemsSelector":".lia-menu-dropdown-items"}}); { "truncateBodyRetainsHtml" : "false", ] ] /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { "actions" : [ "context" : "lia-deleted-state", logmein: [76, 79, 71, 77, 69, 73, 78], $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "actions" : [ { lithadmin: [] "context" : "envParam:quiltName,product,contextId,contextUrl", "actions" : [ LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-373824 .lia-rating-control-passive', '#form_6'); ] "kudosable" : "true", "parameters" : { }, } "context" : "envParam:entity", { { } }, ] } { } } ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); ] ","loaderSelector":"#lineardisplaymessageviewwrapper_5 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); }, }, LITHIUM.AjaxSupport.ComponentEvents.set({ { "event" : "MessagesWidgetAnswerForm", { "action" : "rerender" }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/41962","ajaxErrorEventName":"LITHIUM:ajaxError","token":"Nr8N55nwZnK6a-EHESaZ6BXOKuTnQ9jhv9REjnqoWeY. } }, } LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-373238 .lia-rating-control-passive', '#form_4'); "event" : "removeMessageUserEmailSubscription", { "action" : "rerender" } else { "truncateBody" : "true", { { "componentId" : "forums.widget.message-view", } "action" : "rerender" "actions" : [ } { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_24","feedbackSelector":".InfoMessage"}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_30","feedbackSelector":".InfoMessage"}); { "action" : "rerender" "}); "useSimpleView" : "false", "actions" : [ { "event" : "kudoEntity", { ] "entity" : "373116", "action" : "rerender" "actions" : [ lithstudio: [], ] LITHIUM.StarRating('#any_2', false, 1, 'LITHIUM:starRating'); }, "parameters" : { "initiatorBinding" : true, }, if ( neededkeys[count] == key ) { ], "event" : "removeMessageUserEmailSubscription", })(LITHIUM.jQuery); })(LITHIUM.jQuery); watching = false; "quiltName" : "ForumMessage", "disallowZeroCount" : "false", } LITHIUM.AjaxSupport.fromForm('#form_6', 'GiveRating', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); }, "triggerSelector" : ".lia-panel-dialog-trigger-event-triggerDialogEvent", "showCountOnly" : "false", "actions" : [ "quiltName" : "ForumMessage", "quiltName" : "ForumMessage", { "actions" : [ "event" : "addThreadUserEmailSubscription", } { "event" : "removeMessageUserEmailSubscription", "actions" : [ "context" : "envParam:feedbackData", "initiatorBinding" : true, "action" : "rerender" { "useCountToKudo" : "false", }, "action" : "rerender" } aber diesen monat waren die auch bei mir spät dran. "context" : "envParam:quiltName", { } }, "event" : "AcceptSolutionAction", "kudosLinksDisabled" : "false", LITHIUM.Dialog.options['1699384947'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; { "actions" : [ { { { } Einfach hier bei Aldi-Talk in den persönlichen Bereich einloggen und die Verbindungen der letzten Monate auflisten lassen. { "initiatorDataMatcher" : "data-lia-message-uid" "action" : "pulsate" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_31","feedbackSelector":".InfoMessage"}); { { } "action" : "rerender" { "actions" : [ "actions" : [ "actions" : [ LITHIUM.StarRating('#any_0_3', true, 2, 'LITHIUM:starRating'); Execute whatever should happen when entering the right sequence $(document).keydown(function(e) { "actions" : [ { "eventActions" : [ LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); { "entity" : "373824", "useCountToKudo" : "false", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_21","feedbackSelector":".InfoMessage"}); }, { }, if ( watching ) { { "actions" : [ ] "selector" : "#messageview_3", Sofern Du nicht mehr am kostenfreien Lastschriftverfahren teilnehmen möchtest, kannst Du die Rechnungen selbst zahlen. }, { } ] { } }, { "context" : "envParam:quiltName,message", } { "context" : "", { { ] }, "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_3","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/41962","ajaxErrorEventName":"LITHIUM:ajaxError","token":"q-nIj7wHZb0l-shai5RTlf1-LokrC2r4fgB5UsEqB_g. window.location.replace('/t5/user/userloginpage'); "action" : "pulsate" "action" : "rerender"

Dehoga Gästeregistrierung Formular, Fertighaushersteller In Rumänien, Paul Getty Entführer, Augenklinik Fulda öffnungszeiten, Msv Duisburg Live, Technische Zeichnung App Android,